CD247 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9673
| Article Name: |
CD247 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9673 |
| Supplier Catalog Number: |
P9673 |
| Alternative Catalog Number: |
ABN-P9673-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CD247 (P20963, 52 a.a. - 164 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
| Tag: |
His |
| UniProt: |
919 |
| Buffer: |
In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 10% glycerol) |
| Form: |
Liquid |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
| Target: |
CD247 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
