CD74 (Human) Recombinant Protein, Insect
Catalog Number:
ABN-P9679
| Article Name: |
CD74 (Human) Recombinant Protein, Insect |
| Biozol Catalog Number: |
ABN-P9679 |
| Supplier Catalog Number: |
P9679 |
| Alternative Catalog Number: |
ABN-P9679-2 |
| Manufacturer: |
Abnova |
| Host: |
Insect |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CD74 (P04233, 73 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
| Tag: |
His |
| UniProt: |
972 |
| Buffer: |
In PBS pH 7.4 (10% glycerol) |
| Form: |
Liquid |
| Sequence: |
QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPMHHHHHH |
| Target: |
CD74 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
