CD274 (Human) Recombinant Protein, Insect

Catalog Number: ABN-P9681
Article Name: CD274 (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P9681
Supplier Catalog Number: P9681
Alternative Catalog Number: ABN-P9681-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: SDS-PAGE
Human CD274 (Q9NZQ7, 19 a.a. - 238 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.
Tag: hIgG-His
UniProt: 29126
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: ADLFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERLEPKSCDKTHTCPPCPAPELLGGPSVFLFPP
Target: CD274
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.