CD300C (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9685
Article Name: CD300C (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9685
Supplier Catalog Number: P9685
Alternative Catalog Number: ABN-P9685-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human CD300C (Q08708, 21 a.a. - 183 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 10871
Buffer: In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMGSGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Target: CD300C
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.