CD34 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9693
| Article Name: |
CD34 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9693 |
| Supplier Catalog Number: |
P9693 |
| Alternative Catalog Number: |
ABN-P9693-5 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CD34 (P28906, 1 a.a. - 385 a.a.) full recombinant protein expressed in Escherichia coli. |
| UniProt: |
947 |
| Buffer: |
In 20mM Tris-HCl pH 7.5 (10 mM L-glutathione (reduced)) |
| Form: |
Liquid |
| Sequence: |
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEIS |
| Target: |
CD34 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
