FGL2 (Human) Recombinant Protein

Product Overview

• Article Name: FGL2 (Human) Recombinant Protein
• Biozol Catalog Number: ABN-P9697
• Supplier Catalog Number: P9697
• Alternative Catalog Number: ABN-P9697-100
• Manufacturer: Abnova
• Host: Human
• Category: Proteine/Peptide
• Application: ELISA, FA, SDS-PAGE
• Species Reactivity: Human

Product Description

Human FGL2 (Q14314, 205 a.a. - 439 a.a.) partial recombinant protein with hFc-Flag tag at N-terminus expressed in HEK293 cells.

Product Properties

• Tag: hFc-Flag
• UniProt: 10875
• Buffer: In PBS pH 7.4 (200mM Arginine)
• Form: Liquid
• Sequence: VQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
• Target: FGL2

Application Notes

• Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.

Images

Immobilized Human FGL2, hFc Tag at 1 ug/mL (100 uL/Well) on the plate. Dose response curve for Bio

The purity of Human FGL2 is greater than 90%as determined by SEC-HPLC.

Human FGL2 on Tris-Bis PAGE under reduced condition. The purity is greater than 90%.