DLL3 (Human) Recombinant Protein

Product Overview

• Article Name: DLL3 (Human) Recombinant Protein
• Biozol Catalog Number: ABN-P9698
• Supplier Catalog Number: P9698
• Alternative Catalog Number: ABN-P9698-100
• Manufacturer: Abnova
• Host: Human
• Category: Proteine/Peptide
• Application: ELISA, FA, SDS-PAGE
• Species Reactivity: Human

Product Description

Human DLL3 (Q9NYJ7-1, 311 a.a. - 479 a.a.) partial recombinant protein with His tag and Avi tag at C-terminus expressed in HEK293 cells.

Product Properties

• Tag: His-Avi
• UniProt: 10683
• Buffer: In PBS pH 7.4
• Form: Liquid
• Sequence: VSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAA
• Target: DLL3

Application Notes

• Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.

Images

Immobilized Human DLL3, His Tag at 0.5 ug/mL (100 uL/Well) on the plate. Dose res

The purity of Human DLL3 Domain (311-479) is greater than 95% as determined by SEC-HPLC.

Human DLL3 on Tris-Bis PAGE under reduced condition. The purity isgreater than 95%.