VEGF121 (Human) Recombinant Protein

Catalog Number: ABN-P9700
Article Name: VEGF121 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9700
Supplier Catalog Number: P9700
Alternative Catalog Number: ABN-P9700-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, FA, SDS-PAGE
Species Reactivity: Human
Human VEGF121 (P15692-9, 27 a.a. - 147 a.a.) partial recombinant protein expressed in HEK293 cells.
UniProt: 7422
Buffer: In PBS pH 7.4
Form: Liquid
Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Target: VEGFA
Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.