RAET1L (Human) Recombinant Protein

Catalog Number: ABN-P9710
Article Name: RAET1L (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9710
Supplier Catalog Number: P9710
Alternative Catalog Number: ABN-P9710-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, FA, SDS-PAGE
Species Reactivity: Human
Human RAET1L (Q5VY80, 26 a.a. - 218 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 154064
Buffer: In PBS pH 7.4
Form: Liquid
Sequence: RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSG
Target: RAET1L
Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.