MICA (Human) Recombinant Protein

Catalog Number: ABN-P9714
Article Name: MICA (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9714
Supplier Catalog Number: P9714
Alternative Catalog Number: ABN-P9714-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, FA, SBR, SDS-PAGE
Species Reactivity: Human
Human MICA (Q96QC4, 24 a.a. - 308 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 100507436
Buffer: In PBS pH 7.4
Form: Liquid
Sequence: EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEE
Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.