CD7 (Human) Recombinant Protein

Product Overview

• Article Name: CD7 (Human) Recombinant Protein
• Biozol Catalog Number: ABN-P9719
• Supplier Catalog Number: P9719
• Alternative Catalog Number: ABN-P9719-100
• Manufacturer: Abnova
• Host: Human
• Category: Proteine/Peptide
• Application: ELISA, FA, SDS-PAGE
• Species Reactivity: Human

Product Description

Human CD7 (P09564, 26 a.a. - 180 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.

Product Properties

• Tag: hFc
• UniProt: 924
• Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
• Form: Lyophilized
• Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
• Target: CD7

Application Notes

• Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.

Images

Immobilized Human CD7, hFc Tag at 0.5 ug/mL (100 uL/well) on the plate. Dose response curve for Bio

The purity of Human CD7 is greater than 95% as determined by SEC-HPLC.

Human CD7 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.