CCR8 (Human) Recombinant Protein

Catalog Number: ABN-P9721
Article Name: CCR8 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9721
Supplier Catalog Number: P9721
Alternative Catalog Number: ABN-P9721-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, FA, SDS-PAGE
Species Reactivity: Human
Human CCR8 (P51685-1, 1 a.a. - 35 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 1237
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK
Target: CCR8
Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.