NOTCH3 (Human) Recombinant Protein

Catalog Number: ABN-P9726
Article Name: NOTCH3 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9726
Supplier Catalog Number: P9726
Alternative Catalog Number: ABN-P9726-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, FA, SDS-PAGE
Species Reactivity: Human
Human NOTCH3 (Q9UM47, 1378 a.a. - 1640 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 4854
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: APEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRG
Target: NOTCH3
Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.