GPC3 (Human) Recombinant Protein

Catalog Number: ABN-P9727
Article Name: GPC3 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9727
Supplier Catalog Number: P9727
Alternative Catalog Number: ABN-P9727-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, FA, SDS-PAGE
Species Reactivity: Human
Human GPC3 (P51654-1, 438 a.a. - 554 a.a.) partial recombinant protein expressed in HEK293 cells.
UniProt: 2719
Buffer: In PBS pH 7.4
Form: Liquid
Sequence: RNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHN
Target: GPC3
Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.