TNFSF12 (Human) Recombinant Protein

Catalog Number: ABN-P9729
Article Name: TNFSF12 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9729
Supplier Catalog Number: P9729
Alternative Catalog Number: ABN-P9729-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: ELISA, FA, SBR, SDS-PAGE
Species Reactivity: Human
Human TNFSF12 (O43508-1, 43 a.a. - 249 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 8742
Buffer: In PBS pH 7.4
Form: Liquid
Sequence: SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Target: TNFSF12
Application Dilute: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.