IGSF11 (Human) Recombinant Protein

Catalog Number: ABN-P9740
Article Name: IGSF11 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9740
Supplier Catalog Number: P9740
Alternative Catalog Number: ABN-P9740-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SBR, SDS-PAGE
Species Reactivity: Human
Human IGSF11 (Q5DX21-1, 23 a.a. - 241 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 152404
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
Target: IGSF11
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.