IL2RG (Human) Recombinant Protein

Catalog Number: ABN-P9743
Article Name: IL2RG (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9743
Supplier Catalog Number: P9743
Alternative Catalog Number: ABN-P9743-100
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SBR, SDS-PAGE
Species Reactivity: Human
Human IL2RG (P31785-1, 27 a.a. - 239 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 3561
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Target: IL2RG
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.