LGR5 (Human) Recombinant Protein

Product Overview

• Article Name: LGR5 (Human) Recombinant Protein
• Biozol Catalog Number: ABN-P9744
• Supplier Catalog Number: P9744
• Alternative Catalog Number: ABN-P9744-100
• Manufacturer: Abnova
• Host: Human
• Category: Proteine/Peptide
• Application: FA, SBR, SDS-PAGE
• Species Reactivity: Human

Product Description

Human LGR5 (O75473-1, 22 a.a. - 543 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.

Product Properties

• Tag: hFc
• UniProt: 8549
• Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
• Form: Lyophilized
• Sequence: GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEK
• Target: LGR5

Application Notes

• Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.

Images

Human LGR-5, hFc Tag captured on CM5 Chip via Protein A can bind Human R-Spondin 3, His Tag wit

The purity of Human LGR-5 is greater than 95% as determined by SEC-HPLC.

Human LGR-5 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.