Arhgef17 polyclonal antibody, Rabbit
Catalog Number:
ABN-PAB15715
Article Name: |
Arhgef17 polyclonal antibody, Rabbit |
Biozol Catalog Number: |
ABN-PAB15715 |
Supplier Catalog Number: |
PAB15715 |
Alternative Catalog Number: |
ABN-PAB15715-50 |
Manufacturer: |
Abnova |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse |
Immunogen: |
Recombinant GST fusion protein corresponding to 158 mouse Arhgef17. |
Alternative Names: |
ABN-202409-10_Ab |
Rabbit polyclonal antibody raised against partial recombinant Arhgef17. |
UniProt: |
207212 |
Buffer: |
In PBS (50% glycerol, 0.02% sodium azide) |
Form: |
Liquid |
Sequence: |
MLAGSDAIIRQHKAACLRITALLVCAELLWVGTSAGVVLTIPTSPSTVSCPRAPLSPAGLCQGHTGHVRFLAAVQLPEGFNLLCSTPPPPPDTGPEKLPSLDHRDSPRRRGPTSARPKMLVISGGDGSEDFRLSSGGGGSSETVGRDDSTNHLLLWRV |
Target: |
Arhgef17 |
Application Dilute: |
Western Blot (1:1000)The optimal working dilution should be determined by the end user. |