Kif5c polyclonal antibody, Rabbit

Catalog Number: ABN-PAB15721
Article Name: Kif5c polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB15721
Supplier Catalog Number: PAB15721
Alternative Catalog Number: ABN-PAB15721-50
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-Fr, IHC-P, WB
Species Reactivity: Mouse
Immunogen: Recombinant GST fusion protein corresponding to 82 mouse Kif5c.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against partial recombinant Kif5c.
UniProt: 16574
Buffer: In PBS (50% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: VKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGGSSNSTHYQK
Target: Kif5c
Application Dilute: Western Blot (1:1000)The optimal working dilution should be determined by the end user.