Cstf2t polyclonal antibody, Rabbit
Catalog Number:
ABN-PAB15724
| Article Name: |
Cstf2t polyclonal antibody, Rabbit |
| Biozol Catalog Number: |
ABN-PAB15724 |
| Supplier Catalog Number: |
PAB15724 |
| Alternative Catalog Number: |
ABN-PAB15724-50 |
| Manufacturer: |
Abnova |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
Recombinant GST fusion protein corresponding to 130 mouse Cstf2t. |
| Alternative Names: |
ABN-202409-10_Ab |
| Rabbit polyclonal antibody raised against partial recombinant Cstf2t. |
| UniProt: |
83410 |
| Buffer: |
In PBS (50% glycerol, 0.02% sodium azide) |
| Form: |
Liquid |
| Sequence: |
RGGRESRGMETRPMETEVLEPRGMERRMETCAMETRGMDARGLEMRGPGPSSRGPMTGGIQGPGPINMGAGGPQGPRQVPNIAGVGNPGGTMQGAGIQGGGMQGAGMQGGGMQGAGMQGGGMQGAGMQAGMQGASMQGGMQGAGMQGASKQGGGQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS |
| Target: |
Cstf2t |
| Application Dilute: |
Western Blot (1:1000)The optimal working dilution should be determined by the end user. |
