Csde1 polyclonal antibody, Rabbit
Catalog Number:
ABN-PAB15731
Article Name: |
Csde1 polyclonal antibody, Rabbit |
Biozol Catalog Number: |
ABN-PAB15731 |
Supplier Catalog Number: |
PAB15731 |
Alternative Catalog Number: |
ABN-PAB15731-50 |
Manufacturer: |
Abnova |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse |
Immunogen: |
Recombinant GST fusion protein corresponding to 138 mouse Csde1. |
Alternative Names: |
ABN-202409-10_Ab |
Rabbit polyclonal antibody raised against partial recombinant Csde1. |
UniProt: |
229663 |
Buffer: |
In PBS (50% glycerol, 0.02% sodium azide) |
Form: |
Liquid |
Sequence: |
QNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGVELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPDNSMGFGAERKIRQAGVID |
Target: |
Csde1 |
Application Dilute: |
Western Blot (1:1000)The optimal working dilution should be determined by the end user. |