SLC2A1 polyclonal antibody, Rabbit
Catalog Number:
ABN-PAB19764
| Article Name: |
SLC2A1 polyclonal antibody, Rabbit |
| Biozol Catalog Number: |
ABN-PAB19764 |
| Supplier Catalog Number: |
PAB19764 |
| Alternative Catalog Number: |
ABN-PAB19764-100 |
| Manufacturer: |
Abnova |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IF, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein corresponding to full length human SLC2A1. |
| Alternative Names: |
ABN-202409-10_Ab |
| Rabbit polyclonal antibody raised against full length recombinant SLC2A1. |
| UniProt: |
6513 |
| Buffer: |
In unpurified whole serum |
| Form: |
Liquid |
| Sequence: |
MEPSSKKLTGRLMLAVGGGVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMRE |
| Target: |
SLC2A1 |
| Application Dilute: |
Western Blot (1:200)Immunofluorescence (1:200)The optimal working dilution should be determined by the end user. |
