OTC polyclonal antibody, Rabbit

Catalog Number: ABN-PAB19959
Article Name: OTC polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB19959
Supplier Catalog Number: PAB19959
Alternative Catalog Number: ABN-PAB19959-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids 172-299 of human OTC.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant OTC.
UniProt: 5009
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT
Target: OTC
Application Dilute: Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.