CKAP4 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB19963
Article Name: CKAP4 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB19963
Supplier Catalog Number: PAB19963
Alternative Catalog Number: ABN-PAB19963-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids 411-520 of human CKAP4.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CKAP4.
UniProt: 10970
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ
Target: CKAP4
Application Dilute: ImmunohistochemistryThe optimal working dilution should be determined by the end user.