CLCC1 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20646
Article Name: CLCC1 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20646
Supplier Catalog Number: PAB20646
Alternative Catalog Number: ABN-PAB20646-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human CLCC1.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CLCC1.
UniProt: 23155
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: HDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLL
Target: CLCC1
Application Dilute: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.