SLC6A1 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20649
Article Name: SLC6A1 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20649
Supplier Catalog Number: PAB20649
Alternative Catalog Number: ABN-PAB20649-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human SLC6A1.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant SLC6A1.
UniProt: 6529
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: IYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPG
Target: SLC6A1
Application Dilute: Immunohistochemistry (1:20-1:50)The optimal working dilution should be determined by the end user.