SEC62 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20693
Article Name: SEC62 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20693
Supplier Catalog Number: PAB20693
Alternative Catalog Number: ABN-PAB20693-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human SEC62.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant SEC62.
UniProt: 7095
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
Target: SEC62
Application Dilute: Immunohistochemistry (1:50-1:200)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.