RNF130 polyclonal antibody, Rabbit

Product Overview

• Article Name: RNF130 polyclonal antibody, Rabbit
• Biozol Catalog Number: ABN-PAB20735
• Supplier Catalog Number: PAB20735
• Alternative Catalog Number: ABN-PAB20735-100
• Manufacturer: Abnova
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein corresponding to amino acids of human RNF130.
• Alternative Names: ABN-202409-10_Ab

Product Description

Rabbit polyclonal antibody raised against recombinant RNF130.

Product Properties

• UniProt: 55819
• Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Form: Liquid
• Sequence: PWLSEHCTCPMCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRRSA
• Target: RNF130

Application Notes

• Application Dilute: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.