CLPTM1L polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20770
Article Name: CLPTM1L polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20770
Supplier Catalog Number: PAB20770
Alternative Catalog Number: ABN-PAB20770-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human CLPTM1L.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CLPTM1L.
UniProt: 81037
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL
Target: CLPTM1L
Application Dilute: Immunohistochemistry (1:500-1:1000)The optimal working dilution should be determined by the end user.