YIF1A polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20773
Article Name: YIF1A polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20773
Supplier Catalog Number: PAB20773
Alternative Catalog Number: ABN-PAB20773-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human YIF1A.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant YIF1A.
UniProt: 10897
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Target: YIF1A
Application Dilute: Immunohistochemistry (1:50-1:200)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.