KCNS3 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20779
Article Name: KCNS3 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20779
Supplier Catalog Number: PAB20779
Alternative Catalog Number: ABN-PAB20779-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human KCNS3.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant KCNS3.
UniProt: 3790
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA
Target: KCNS3
Application Dilute: Immunohistochemistry (1:10-1:20)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.