TMEM41B polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20785
Article Name: TMEM41B polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20785
Supplier Catalog Number: PAB20785
Alternative Catalog Number: ABN-PAB20785-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human TMEM41B.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant TMEM41B.
UniProt: 440026
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS
Target: TMEM41B
Application Dilute: Immunohistochemistry (1:20-1:50)The optimal working dilution should be determined by the end user.