MARC2 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20792
Article Name: MARC2 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20792
Supplier Catalog Number: PAB20792
Alternative Catalog Number: ABN-PAB20792-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human MARC2.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant MARC2.
UniProt: 54996
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: FQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRL
Target: MARC2
Application Dilute: Immunohistochemistry (1:500-1:1000)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.