UGCGL1 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20796
Article Name: UGCGL1 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20796
Supplier Catalog Number: PAB20796
Alternative Catalog Number: ABN-PAB20796-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human UGCGL1.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant UGCGL1.
UniProt: 56886
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
Target: UGCGL1
Application Dilute: Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.