FCGRT polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20797
Article Name: FCGRT polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20797
Supplier Catalog Number: PAB20797
Alternative Catalog Number: ABN-PAB20797-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human FCGRT.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant FCGRT.
UniProt: 2217
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
Target: FCGRT
Application Dilute: Immunohistochemistry (1:20-1:50)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.