HADHA polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20813
Article Name: HADHA polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20813
Supplier Catalog Number: PAB20813
Alternative Catalog Number: ABN-PAB20813-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human HADHA.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant HADHA.
UniProt: 3030
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
Target: HADHA
Application Dilute: Immunohistochemistry (1:20-1:50)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.