STXBP2 polyclonal antibody, Rabbit
Catalog Number:
ABN-PAB20815
Article Name: |
STXBP2 polyclonal antibody, Rabbit |
Biozol Catalog Number: |
ABN-PAB20815 |
Supplier Catalog Number: |
PAB20815 |
Alternative Catalog Number: |
ABN-PAB20815-100 |
Manufacturer: |
Abnova |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC-P |
Species Reactivity: |
Human |
Immunogen: |
Recombinant protein corresponding to amino acids of human STXBP2. |
Alternative Names: |
ABN-202409-10_Ab |
Rabbit polyclonal antibody raised against recombinant STXBP2. |
UniProt: |
6813 |
Buffer: |
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Form: |
Liquid |
Sequence: |
CPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKLN |
Target: |
STXBP2 |
Application Dilute: |
Immunohistochemistry (1:20-1:50)The optimal working dilution should be determined by the end user. |