TBC1D15 polyclonal antibody, Rabbit
Catalog Number:
ABN-PAB20818
| Article Name: |
TBC1D15 polyclonal antibody, Rabbit |
| Biozol Catalog Number: |
ABN-PAB20818 |
| Supplier Catalog Number: |
PAB20818 |
| Alternative Catalog Number: |
ABN-PAB20818-100 |
| Manufacturer: |
Abnova |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein corresponding to amino acids of human TBC1D15. |
| Alternative Names: |
ABN-202409-10_Ab |
| Rabbit polyclonal antibody raised against recombinant TBC1D15. |
| UniProt: |
64786 |
| Buffer: |
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Form: |
Liquid |
| Sequence: |
LRVLEKDAEVIVDWRPLDDALDSSSILYARKDSSSVVEWTQAPKERGHRGSEHLNSYEAEWDMVNTVSFKRKPHTNGDAPSHRNGKSKWSFLFSLTDLKSIKQNKEGMGWSYLVFCLKDDVVLPALHF |
| Target: |
TBC1D15 |
| Application Dilute: |
Immunohistochemistry (1:10-1:20)The optimal working dilution should be determined by the end user. |
