NSRP1 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20819
Article Name: NSRP1 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20819
Supplier Catalog Number: PAB20819
Alternative Catalog Number: ABN-PAB20819-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human NSRP1.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant NSRP1.
UniProt: 84081
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: KREVGVQSSERNQDRKESSPNSRAKDKFLDQERSNKMRNMAKDKERNQEKPSNSESSLGAKHRLTEEGQEKGKEQERPPEAVSKFAKRNNEETVM
Target: NSRP1
Application Dilute: Immunohistochemistry (1:500-1:1000)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.