CD163L1 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20835
Article Name: CD163L1 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20835
Supplier Catalog Number: PAB20835
Alternative Catalog Number: ABN-PAB20835-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human CD163L1.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CD163L1.
UniProt: 283316
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
Target: CD163L1
Application Dilute: Immunohistochemistry (1:200-1:500)The optimal working dilution should be determined by the end user.