WSCD1 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20856
Article Name: WSCD1 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20856
Supplier Catalog Number: PAB20856
Alternative Catalog Number: ABN-PAB20856-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human WSCD1.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant WSCD1.
UniProt: 23302
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: NITHAFPSSLIQANVTVGTCSGFCSQKEFPLAILRGWECYCAYPTPRFNLRDAMDSSVCGQDPEAQRLAEYCEVYQTPVQDTRCTDRRFLPNKSKVFVALSSFPGAG
Target: WSCD1
Application Dilute: Immunohistochemistry (1:50-1:200)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.