LPP polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20941
Article Name: LPP polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20941
Supplier Catalog Number: PAB20941
Alternative Catalog Number: ABN-PAB20941-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human LPP.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant LPP.
UniProt: 4026
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: VVAPKPKYNPYKQPGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKST
Target: LPP
Application Dilute: Immunohistochemistry (1:50-1:200)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.