DOCK5 polyclonal antibody, Rabbit
Catalog Number:
ABN-PAB20955
Article Name: |
DOCK5 polyclonal antibody, Rabbit |
Biozol Catalog Number: |
ABN-PAB20955 |
Supplier Catalog Number: |
PAB20955 |
Alternative Catalog Number: |
ABN-PAB20955-100 |
Manufacturer: |
Abnova |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IF |
Species Reactivity: |
Human |
Immunogen: |
Recombinant protein corresponding to amino acids of human DOCK5. |
Alternative Names: |
ABN-202409-10_Ab |
Rabbit polyclonal antibody raised against recombinant DOCK5. |
UniProt: |
80005 |
Buffer: |
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Form: |
Liquid |
Sequence: |
VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL |
Target: |
DOCK5 |
Application Dilute: |
Immunofluorescence (0.25-2 ug/mL)The optimal working dilution should be determined by the end user. |