SGEF polyclonal antibody, Rabbit

Catalog Number: ABN-PAB20956
Article Name: SGEF polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB20956
Supplier Catalog Number: PAB20956
Alternative Catalog Number: ABN-PAB20956-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human SGEF.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant SGEF.
UniProt: 26084
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: PEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSPAALKVGKQQIIPKSLASEIKISKSNNQNV
Target: SGEF
Application Dilute: Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.