UQCRQ polyclonal antibody, Rabbit

Catalog Number: ABN-PAB24512
Article Name: UQCRQ polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB24512
Supplier Catalog Number: PAB24512
Alternative Catalog Number: ABN-PAB24512-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human UQCRQ.
Rabbit polyclonal antibody raised against recombinant UQCRQ.
UniProt: 27089
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR
Target: UQCRQ
Application Dilute: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.