DDX60 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB24522
Article Name: DDX60 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB24522
Supplier Catalog Number: PAB24522
Alternative Catalog Number: ABN-PAB24522-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human DDX60.
Rabbit polyclonal antibody raised against recombinant DDX60.
UniProt: 55601
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV
Target: DDX60
Application Dilute: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.