MRPL20 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB24526
Article Name: MRPL20 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB24526
Supplier Catalog Number: PAB24526
Alternative Catalog Number: ABN-PAB24526-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human MRPL20.
Rabbit polyclonal antibody raised against recombinant MRPL20.
UniProt: 55052
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: ASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Target: MRPL20
Application Dilute: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.