ZC3HAV1 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB24543
Article Name: ZC3HAV1 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB24543
Supplier Catalog Number: PAB24543
Alternative Catalog Number: ABN-PAB24543-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human ZC3HAV1.
Rabbit polyclonal antibody raised against recombinant ZC3HAV1.
UniProt: 56829
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: NGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHL
Target: ZC3HAV1
Application Dilute: Immunohistochemistry (1:20-1:50)The optimal working dilution should be determined by the end user.