EMID1 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB27457
Article Name: EMID1 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB27457
Supplier Catalog Number: PAB27457
Alternative Catalog Number: ABN-PAB27457-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human EMID1.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant EMID1.
UniProt: 129080
Buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: RNWCSYVVTRTISCHVQNGTYLQRVLQNCPWPMSCPGSSYRTVVRPTYKVMYKIVTAREWRCCPGHSGVSCEEVAASSASLEPMWSGSTMRRMALRPTAFSGCLNCSKVSELTERLKVLEAKMTMLTVIEQPVPPTPAT
Target: EMID1
Application Dilute: Immunohistochemistry (1:50-1:200)Western Blot (1:100-1:250)The optimal working dilution should be determined by the end user.